Recombinant Full Length Suid Herpesvirus 1 Envelope Glycoprotein E(Ge) Protein, His-Tagged
Cat.No. : | RFL21657SF |
Product Overview : | Recombinant Full Length Suid herpesvirus 1 Envelope glycoprotein E(gE) Protein (P08354) (21-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Suid herpesvirus 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-577) |
Form : | Lyophilized powder |
AA Sequence : | TEAPSLSAETTPGPVTEVPSPSAEVWDLSTEAGDDDLDGDLNGDDRRAGFGSALASLREA PPAHLVNVSEGANFTLDARGDGAVVAGIWTFLPVRGCDAVAVTMVCFETACHPDLVLGRA CVPEAPERGIGDYLPPEVPRLQREPPIVTPERWSPHLTVRRATPNDTGLYTLHDASGPRA VFFVAVGDRPPAPLAPVGPARHEPRFHALGFHSQLFSPGDTFDLMPRVVSDMGDSRENFT ATLDWYYARAPPRCLLYYVYEPCIYHPRAPECLRPVDPACSFTSPARAALVARRAYASCS PLLGDRWLTACPFDAFGEEVHTNATADESGLYVLVMTHNGHVATWDYTLVATAAEYVTVI KELTAPARAPGTPWGPGGGDDAIYVDGVTTPAPPARPWNPYGRTTPGRLFVLALGSFVMT CVVGGAVWLCVLCSRRRAASRPFRVPTRAGTRMLSPVYTSLPTHEDYYDGDDDDEEAGDA RRRPSSPGGDSGYEGPYVSLDAEDEFSSDEDDGLYVRPEEAPRSGFDVWFRDPEKPEVTN GPNYGVTASRLLNARPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gE |
Synonyms | gE; Envelope glycoprotein E; gE |
UniProt ID | P08354 |
◆ Recombinant Proteins | ||
Bcl2l1-544M | Recombinant Mouse Bcl2l1 protein | +Inquiry |
UL55-179C | Recombinant CMV UL55 | +Inquiry |
Arhgef39-1695M | Recombinant Mouse Arhgef39 Protein, Myc/DDK-tagged | +Inquiry |
SLC34A2-579H | Active Recombinant Human SLC34A2 protein, His-Flag-tagged | +Inquiry |
Git1-3215M | Recombinant Mouse Git1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
Prothrombin-60H | Native Human Prothrombin Frag 2 | +Inquiry |
LDL-399H | Native Human Low Density Lipoprotein, Oxidized | +Inquiry |
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCAF12L1-7058HCL | Recombinant Human DCAF12L1 293 Cell Lysate | +Inquiry |
PHLDA3-3219HCL | Recombinant Human PHLDA3 293 Cell Lysate | +Inquiry |
SFXN3-1893HCL | Recombinant Human SFXN3 293 Cell Lysate | +Inquiry |
ZNF18-133HCL | Recombinant Human ZNF18 293 Cell Lysate | +Inquiry |
H3F3A-5654HCL | Recombinant Human H3F3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gE Products
Required fields are marked with *
My Review for All gE Products
Required fields are marked with *
0
Inquiry Basket