Recombinant Full Length Streptomyces Coelicolor Upf0233 Membrane Protein Sco3854(Sco3854) Protein, His-Tagged
Cat.No. : | RFL20587SF |
Product Overview : | Recombinant Full Length Streptomyces coelicolor UPF0233 membrane protein SCO3854(SCO3854) Protein (Q9XA10) (1-84aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces coelicolor |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-84) |
Form : | Lyophilized powder |
AA Sequence : | MPKSRIRKKADYTPPPSKQATSIKLTSRGWVAPVMLAMFVIGLAWIVVFYVTDGSLPIDS LGNWNIVVGFGFIAAGFGVSTQWK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crgA |
Synonyms | crgA; SCO3854; SCH69.24; Cell division protein CrgA |
UniProt ID | Q9XA10 |
◆ Recombinant Proteins | ||
MDH1B-793H | Recombinant Human MDH1B, His-tagged | +Inquiry |
RFL20316SF | Recombinant Full Length Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
RFL8711PF | Recombinant Full Length Pongo Abelii Tumor Protein P53-Inducible Protein 11(Tp53I11) Protein, His-Tagged | +Inquiry |
Reep2-5450M | Recombinant Mouse Reep2 Protein, Myc/DDK-tagged | +Inquiry |
PHKG1-0208H | Recombinant Human PHKG1 Protein (T2-Y387), Tag Free | +Inquiry |
◆ Native Proteins | ||
TF-31158TH | Native Human TF | +Inquiry |
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCA3-2HCL | Recombinant Human ABCA3 lysate | +Inquiry |
MOCS1-414HCL | Recombinant Human MOCS1 lysate | +Inquiry |
CYP2E1-7111HCL | Recombinant Human CYP2E1 293 Cell Lysate | +Inquiry |
EIF4EBP2-6648HCL | Recombinant Human EIF4EBP2 293 Cell Lysate | +Inquiry |
CCDC117-7786HCL | Recombinant Human CCDC117 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All crgA Products
Required fields are marked with *
My Review for All crgA Products
Required fields are marked with *
0
Inquiry Basket