Recombinant Full Length Streptococcus Pneumoniae 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase(Plsc) Protein, His-Tagged
Cat.No. : | RFL23319SF |
Product Overview : | Recombinant Full Length Streptococcus pneumoniae 1-acyl-sn-glycerol-3-phosphate acyltransferase(plsC) Protein (Q8DNY1) (1-264aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-264) |
Form : | Lyophilized powder |
AA Sequence : | MIRYNNNKKTIEGDRMFYTYLRGLVVLLLWSINGNAHYHNTDKIPNQDENYILVAPHRTW WDPVYMAFATKPKQFIFMAKKELFTNRIFGWWIRMCGAFPIDRENPSASAIKYPINVLKK SDRSLIMFPSGSRHSNDVKGGAALIAKMAKVRIMPVTYTGPMTLKGLISRERVDMNFGNP IDISDIKKMNDEGIETVANRIQTEFQRLDEETKQWHNDKKPNPLWWFIRIPALILAIILA ILTIIFSFIASFIWNPDKKREELA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsC |
Synonyms | plsC; spr1465; 1-acyl-sn-glycerol-3-phosphate acyltransferase; 1-AGP acyltransferase; 1-AGPAT; 1-acyl-G3P acyltransferase; Lysophosphatidic acid acyltransferase; LPAAT; Phosphatidic acid synthase; PA synthase |
UniProt ID | Q8DNY1 |
◆ Recombinant Proteins | ||
DNMT1-6950M | Recombinant Mouse DNMT1, GST-tagged | +Inquiry |
MICALL1-1628H | Recombinant Human MICALL1 | +Inquiry |
Chat-1836R | Recombinant Rat Choline O-Acetyltransferase | +Inquiry |
PLAA-1758H | Recombinant Human PLAA, GST-tagged | +Inquiry |
RFL12190EF | Recombinant Full Length Escherichia Coli O6:K15:H31 Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
LTF-28999TH | Native Human LTF | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
C3b-03M | Native Monkey C3b Protein | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
◆ Cell & Tissue Lysates | ||
HORMAD2-5431HCL | Recombinant Human HORMAD2 293 Cell Lysate | +Inquiry |
LAMP1-1486RCL | Recombinant Rat LAMP1 cell lysate | +Inquiry |
C10orf2-8371HCL | Recombinant Human C10orf2 293 Cell Lysate | +Inquiry |
IL17B-5244HCL | Recombinant Human IL17B 293 Cell Lysate | +Inquiry |
RPS6KA1-2162HCL | Recombinant Human RPS6KA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All plsC Products
Required fields are marked with *
My Review for All plsC Products
Required fields are marked with *
0
Inquiry Basket