Recombinant Full Length Staphylococcus Saprophyticus Subsp. Saprophyticus Probable Ctpa-Like Serine Protease(Ssp1319) Protein, His-Tagged
Cat.No. : | RFL29298SF |
Product Overview : | Recombinant Full Length Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease(SSP1319) Protein (Q49XN1) (1-491aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus saprophyticus subsp. saprophyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-491) |
Form : | Lyophilized powder |
AA Sequence : | MSESKDTTEVNQEVNEKASSQSTKKQINFKRSHFIIILIVTILVTAMIAVFATIGISHWT SGLNSDQRDEMKKVEQVYQTLDDEYYKDTSSEELGTAAIDGMVKKLDDPYSDYMTKKETK SFNEDVSGDFVGIGAEMQKKGNQIQITSPMKQSPAEKAGIQPKDVVTKVNGKSIKGQPLE AIVKKVRGKQGTKVTLTIERGGQAHDITIKRDKIHVKSVEYQKHGDVGVFTINKFQNSTS GELKSAIIKAHKDGIRKIVLDLRNNPGGLLDEAVKMANIFIDKNETVVQLEKGKHKEAIK ASNDASKEAKDMDVSILVNKGSASASEVFTGAMKDYNKAKVYGSKTFGKGIVQTTREFED GSLLKFTNMKWLTPKSHYIHGKGITPDKKIEEPAYQSLNVIPSNKTYQLGDDDKNVKTMK VGLNVLGYHINNHSTEFDSELEDALKSFQKKNNLDVNGTFNKSTNEKFTQQLVEKANKED TVLNELLKKLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SSP1319 |
Synonyms | SSP1319; Probable CtpA-like serine protease |
UniProt ID | Q49XN1 |
◆ Recombinant Proteins | ||
CLUL1-5803Z | Recombinant Zebrafish CLUL1 | +Inquiry |
RFL8762LF | Recombinant Full Length Legionella Pneumophila Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
UGCG-2981Z | Recombinant Zebrafish UGCG | +Inquiry |
TPM4-17259M | Recombinant Mouse TPM4 Protein | +Inquiry |
CEBPZ-26494TH | Recombinant Human CEBPZ, His-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
Ovary-025H | Human Ovary Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD81-848HCL | Recombinant Human CD81 cell lysate | +Inquiry |
ITGA5&ITGB6-854HCL | Recombinant Human ITGA5&ITGB6 cell lysate | +Inquiry |
BBS7-158HCL | Recombinant Human BBS7 cell lysate | +Inquiry |
MXD4-1157HCL | Recombinant Human MXD4 cell lysate | +Inquiry |
ESRRA-576HCL | Recombinant Human ESRRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSP1319 Products
Required fields are marked with *
My Review for All SSP1319 Products
Required fields are marked with *
0
Inquiry Basket