Recombinant Full Length Staphylococcus Saprophyticus Subsp. Saprophyticus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL21560SF |
Product Overview : | Recombinant Full Length Staphylococcus saprophyticus subsp. saprophyticus Lipoteichoic acid synthase(ltaS) Protein (Q49VR4) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus saprophyticus subsp. saprophyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | NEDDLTKVLNYTKQKQTEPNKEYFGAAKKKNIIKIHLESFQTFLINKKVNGEEVTPFLNK LSTGNEGYRYYPNFYHQTGQGKTSDSEFTMDNSLFGLPQGSAYSLKGDNTYQSLPAILDQ QQGYTSSVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSEDNIENLGLKDKEFFKESAD YLAKEKQPFYNHLITLTNHYPFTVSPEDASIEKPNTGDSTVDGYIQTARYLDESLEEFVN ELKKKGLYDDSVIMIYGDHYGISENHNKAMEKLLGEDITPAKFNDLNRTGFWLKIPGKEG TVDKTYAGQADVMPTILHLMGIDTKNYLMMGTDLLSKDHNDTVPFRNGDFVTKDYKYVNG RIYDNKNNEPMTEKPKDFEKRKQQSEKDLQMSDDVLNGDLLRFYDNPDFDKIKPSEYEYK TGPKGQERK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SSP2001; Lipoteichoic acid synthase |
UniProt ID | Q49VR4 |
◆ Recombinant Proteins | ||
DFNB59-2794H | Recombinant Human DFNB59 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11534BF | Recombinant Full Length Brucella Melitensis Biotype 2 Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
Pex5-4799M | Recombinant Mouse Pex5 Protein, Myc/DDK-tagged | +Inquiry |
DUSP22-12213H | Recombinant Human DUSP22, GST-tagged | +Inquiry |
CCDC87-1375M | Recombinant Mouse CCDC87 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Mucin-232P | Native Porcine Mucin | +Inquiry |
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
TF-262H | Native Human Transferrin | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
a-Actinin-20C | Native Chicken a-Actinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-274H | Human Kidney Membrane Tumor Lysate | +Inquiry |
GLUD2-716HCL | Recombinant Human GLUD2 cell lysate | +Inquiry |
PNLIPRP2-1281HCL | Recombinant Human PNLIPRP2 cell lysate | +Inquiry |
BIRC7-8448HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
H2AFV-5660HCL | Recombinant Human H2AFV 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket