Recombinant Full Length Staphylococcus Haemolyticus Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL6116SF |
Product Overview : | Recombinant Full Length Staphylococcus haemolyticus Sensor protein vraS(vraS) Protein (Q4L7J6) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Haemolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MNHYLRAIGSMLILVYSMLTAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLVIILLC IIVGSILAYKINQQNQWIKSQIEHAIEGETVGINDQNIELYNETIDLYQTLVPLNQELHR LRMKTQNLTNENYNMNDVKVKKIIENERQRLARELHDSVSQQLFAASMMLSAIKETKLEA PLDQQIPVLEKMVQESQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVIHDI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNQQDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNREDDNNDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; SH1070; Sensor protein VraS |
UniProt ID | Q4L7J6 |
◆ Recombinant Proteins | ||
MAPK1IP1L-2492R | Recombinant Rhesus Macaque MAPK1IP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
FEM1A-1506R | Recombinant Rhesus Macaque FEM1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Tetra-Ubiquitin-53H | Recombinant Human Tetra-Ubiquitin Protein (Linear), 6×His-tagged | +Inquiry |
IRAK3-5731HF | Recombinant Full Length Human IRAK3 Protein, GST-tagged | +Inquiry |
RFL6452RF | Recombinant Full Length Rat Taste Receptor Type 2 Member 140(Tas2R140) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
Fibrin-001H | Native Human Fibrin Protein | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFC1-339HCL | Recombinant Human CFC1 cell lysate | +Inquiry |
CCHCR1-167HCL | Recombinant Human CCHCR1 lysate | +Inquiry |
IGKV1-5-845HCL | Recombinant Human IGKV1-5 cell lysate | +Inquiry |
QTRT1-2634HCL | Recombinant Human QTRT1 293 Cell Lysate | +Inquiry |
Lung-308H | Human Lung Cytoplasmic Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket