Recombinant Full Length Staphylococcus Epidermidis Upf0421 Protein Serp1427(Serp1427) Protein, His-Tagged
Cat.No. : | RFL6905SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis UPF0421 protein SERP1427(SERP1427) Protein (Q5HN45) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MNDKWYRHIIGARTIKTGLATFFTSLFCMLLNLTPIFAILTAIVTIEPTAKASLKKGYKR LPATVIGALFAVVFTYVFGDQSPLSYALSATFTILICTKLNLQVGTTVAVLTSVAMIPGI HEAYVFNFFSRLLTALIGLVTAGLVNFIILPPKYYHQLEEQLALSEKKMYRLFYERCNEL LLGKFSSEKTSKELSKLNIIAQKVETLMSYQRDELHYHKNEDNWKLLNRLTNRAYNNRLF ISHLSNIIYLPKHTSIAFDANEKIALINISNSINGIIQKGSFARQKKSIATLKSSVKQMD EFDQNQMKSTLIYEILLIYKILDSRYAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SERP1427 |
Synonyms | SERP1427; UPF0421 protein SERP1427 |
UniProt ID | Q5HN45 |
◆ Recombinant Proteins | ||
LCE1B-520H | Recombinant Human LCE1B, GST-tagged | +Inquiry |
ACP1-4837H | Recombinant Human ACP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DEGA-1227B | Recombinant Bacillus subtilis DEGA protein, His-tagged | +Inquiry |
SLC15A5-8226M | Recombinant Mouse SLC15A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2S1-12361H | Recombinant Human EIF2S1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM31-783HCL | Recombinant Human TRIM31 293 Cell Lysate | +Inquiry |
DCTN2-7042HCL | Recombinant Human DCTN2 293 Cell Lysate | +Inquiry |
RPL27-2211HCL | Recombinant Human RPL27 293 Cell Lysate | +Inquiry |
BAG2-8527HCL | Recombinant Human BAG2 293 Cell Lysate | +Inquiry |
SMCP-1664HCL | Recombinant Human SMCP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERP1427 Products
Required fields are marked with *
My Review for All SERP1427 Products
Required fields are marked with *
0
Inquiry Basket