Recombinant Full Length Staphylococcus Epidermidis Upf0421 Protein Se_1574(Se_1574) Protein, His-Tagged
Cat.No. : | RFL17866SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis UPF0421 protein SE_1574(SE_1574) Protein (Q8CRU8) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MNDKWYRHIIGARTIKTGLATFFTSLFCMLLNLTPIFAILTAIVTIEPTAKASLKKGYKR LPATVIGALFAVVFTYVFGDQSPLSYALSATFTILICTKLNLQVGTTVAVLTSVAMIPSI HEAYVFNFFSRLLTALIGLVTAGLVNFIILPPKYYHQLEEQLALSEKKMYRLFYERCNEL LLGKFSSEKTSKELSKLNIIAQKVETLMSYQRDELHYHKNEDNWKLLNRLTNRAYNNRLF ISHLSNIIYLPKHTSIAFDANEKIALINISNSINGIIQKGSFARQKKSIATLKSSVKQMD EFDQNQMKSTLIYEILLIYKILDSRYAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SE_1574 |
Synonyms | SE_1574; UPF0421 protein SE_1574 |
UniProt ID | Q8CRU8 |
◆ Native Proteins | ||
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
Laminin-01H | Native Human Laminin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B4-5373HCL | Recombinant Human HSD17B4 293 Cell Lysate | +Inquiry |
STRA8-1386HCL | Recombinant Human STRA8 293 Cell Lysate | +Inquiry |
KCNK7-5031HCL | Recombinant Human KCNK7 293 Cell Lysate | +Inquiry |
ANP32C-8841HCL | Recombinant Human ANP32C 293 Cell Lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SE_1574 Products
Required fields are marked with *
My Review for All SE_1574 Products
Required fields are marked with *
0
Inquiry Basket