Recombinant Full Length Staphylococcus Epidermidis Na(+)/H(+) Antiporter Subunit G1(Mnhg1) Protein, His-Tagged
Cat.No. : | RFL1108SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Na(+)/H(+) antiporter subunit G1(mnhG1) Protein (Q8CPV4) (1-118aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-118) |
Form : | Lyophilized powder |
AA Sequence : | MIATIVTSVSIIFVVLGALISAFAATGLIRLRDVYSRAHAAGKAATLGAMFLLFGAFLYF IGTEGYVNMQLIIGIIFVFITGPLSSHLIMKAAYNIKTPYTKDTKIDEIKEDMKHTKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhG1 |
Synonyms | mnhG1; SE_0640; Na(+/H(+ antiporter subunit G1; Mnh complex subunit G1 |
UniProt ID | Q8CPV4 |
◆ Recombinant Proteins | ||
PDGFRB-471H | Recombinant Human PDGFRB, ENLYFQ tagged | +Inquiry |
RFL30204DF | Recombinant Full Length Debaryomyces Hansenii Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged | +Inquiry |
PPP2R2D-10165Z | Recombinant Zebrafish PPP2R2D | +Inquiry |
HDAC8-1655H | Recombinant Human Histone Deacetylase 8 | +Inquiry |
Spike-1216V | Recombinant COVID-19 Spike RBD protein(Arg319-Phe541), rFc-tagged | +Inquiry |
◆ Native Proteins | ||
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
Lectin-1773E | Active Native Erythrina Cristagalli Lectin Protein, Biotinylated | +Inquiry |
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
ALP-8330C | Native Calf ALP | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF208-483HCL | Recombinant Human RNF208 cell lysate | +Inquiry |
DRD1-20HL | Recombinant Human DRD1 HEK293T cell lysate | +Inquiry |
WNT5A-293HCL | Recombinant Human WNT5A 293 Cell Lysate | +Inquiry |
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
MYBBP1A-4044HCL | Recombinant Human MYBBP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhG1 Products
Required fields are marked with *
My Review for All mnhG1 Products
Required fields are marked with *
0
Inquiry Basket