Recombinant Full Length Debaryomyces Hansenii Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL30204DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii Palmitoyltransferase PFA5(PFA5) Protein (Q6BP97) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MVFDPKLFKYAWAKRVIPICVILGLGYIDFACFYALGYREIYKFHSHGVAISLWVILAWC EVCVIAYWVLLVVTGPGKAPRVKPFNLYSSEDTSDLTPVPDYFFCDESGYPFWCSQCQSI KLPRTLHSKDRNYCILKFDHYCVWVGTVIGQRNYKYFLNFLIWFLMFFIVTLIYLSRYTK SNYDRGTKDIDHNYIVLYILSGYWILILSSLLAAHLWYVVHNMTTIDDMNIKKVKRYSRW TSNNDKTKRKDVRKIPGEETGIRYINIRYNDTRVIVQYTLNDFPFSFGFKRNWQNLWLNN NRTNGDFTQHESSYSRKRLAISFLLFLVPYVDLVYPSRERINVSDVEKSTLDSLYSHRLI EYEQYNDRLNDKFLDYINSKIKNNEFHMPRYLSPLAEDQQSSSEGSRPDNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA5 |
Synonyms | PFA5; DEHA2E15356g; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5 |
UniProt ID | Q6BP97 |
◆ Recombinant Proteins | ||
RFL35043HF | Recombinant Full Length Human Uncharacterized Aarf Domain-Containing Protein Kinase 5(Adck5) Protein, His-Tagged | +Inquiry |
CCL1-29H | Recombinant Human Chemokine (C-C Motif) Ligand 1 | +Inquiry |
SLC30A2-4094Z | Recombinant Zebrafish SLC30A2 | +Inquiry |
SCO5481-1435S | Recombinant Streptomyces coelicolor A3(2) SCO5481 protein, His-tagged | +Inquiry |
HINT1-1206HFL | Recombinant Full Length Human HINT1 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
CKB-8079H | Active Native Human CKB protein | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
IgM-337G | Native Goat IgM | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
HB-40C | Native Cattle Hemoglobin (HB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53TG1-1812HCL | Recombinant Human TP53TG1 cell lysate | +Inquiry |
RPL15-2222HCL | Recombinant Human RPL15 293 Cell Lysate | +Inquiry |
TLE6-1049HCL | Recombinant Human TLE6 293 Cell Lysate | +Inquiry |
PLTP-2065HCL | Recombinant Human PLTP cell lysate | +Inquiry |
PIAS4-3201HCL | Recombinant Human PIAS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PFA5 Products
Required fields are marked with *
My Review for All PFA5 Products
Required fields are marked with *
0
Inquiry Basket