Recombinant Full Length Staphylococcus Epidermidis Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL26487SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Lipoteichoic acid synthase(ltaS) Protein (Q8CQ10) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQKRTEPNPEYYGAAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGNQDFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAYSLKGDNTYQSLPAILDQ KQGYTSNVMHGDYKTFWNRDQVYKHFGIDNFYDATYYDMSDDNIVNLGLKDKPFFKASAD YQSKMKKPFYSHLITLTNHYPFTLDEEDASIDKPNTGDSTVDGYIQTAHYLDQALEEYIT DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWLKVPGKSG GVNKEYAGQMDVMPTLLHLVGIDSKNYLMFGSDMFSKQHNNVVPFRNGDFITEDYKYVNG KIYSNKDNELLTEKPKDFDKNKKQVEKDLEMSDSVLNGDLFRFYKNPDFKKVNPGKYEYK SGPKGNEKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SE_0494; Lipoteichoic acid synthase |
UniProt ID | Q8CQ10 |
◆ Native Proteins | ||
AFP-412H | Native Human AFP Protein | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
IGHG4 -23H | Native Human IgG4 | +Inquiry |
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB2-965CCL | Recombinant Canine EFNB2 cell lysate | +Inquiry |
NLN-3806HCL | Recombinant Human NLN 293 Cell Lysate | +Inquiry |
ASPN-138HCL | Recombinant Human ASPN cell lysate | +Inquiry |
MRPL16-4193HCL | Recombinant Human MRPL16 293 Cell Lysate | +Inquiry |
C1orf144-8181HCL | Recombinant Human C1orf144 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket