Recombinant Full Length Staphylococcus Epidermidis Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL33397SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Lipoteichoic acid synthase(ltaS) Protein (Q5HR16) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQKRTEPNPEYYGAAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGNQDFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAYSLKGDNTYQSLPAILDQ KQGYTSNVMHGDYKTFWNRDQVYKHFGIDNFYDATYYDMSDDNIVNLGLKDKPFFKASAD YQSKMKKPFYSHLITLTNHYPFTLDEEDASIDKPNTGDSTVDGYIQTAHYLDQALEEYIT DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWLKVPGKSG GVNKEYAGQMDVMPTLLHLVGIDSKNYLMFGSDMFSKQHNNVVPFRNGDFITEDYKYVNG KIYSNKDNELLTEKPKDFDKNKKQVEKDLEMSDSVLNGDLFRFYKNPDFKKVNPGKYEYK SGPKGNEKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SERP0379; Lipoteichoic acid synthase |
UniProt ID | Q5HR16 |
◆ Recombinant Proteins | ||
NOG-320C | Recombinant Chicken NOG Protein, His-tagged | +Inquiry |
RFL23597HF | Recombinant Full Length Human C-X-C Chemokine Receptor Type 5(Cxcr5) Protein, His-Tagged | +Inquiry |
ME2-644H | Recombinant Human ME2 | +Inquiry |
CLDN6-4312C | Recombinant Cynomolgus CLDN6 Full Length Transmembrane protein(VLPs) | +Inquiry |
CTSB-785H | Recombinant Human CTSB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP2-533HCL | Recombinant Human RBP2 lysate | +Inquiry |
GYPB-313HCL | Recombinant Human GYPB lysate | +Inquiry |
Duodenum-113H | Human Duodenum Membrane Lysate | +Inquiry |
PLAG1-3134HCL | Recombinant Human PLAG1 293 Cell Lysate | +Inquiry |
CYTH2-7094HCL | Recombinant Human CYTH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket