Recombinant Full Length Staphylococcus Epidermidis Cardiolipin Synthase 2(Cls2) Protein, His-Tagged
Cat.No. : | RFL8302SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Cardiolipin synthase 2(cls2) Protein (Q5HMD3) (1-488aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-488) |
Form : | Lyophilized powder |
AA Sequence : | MALHQSNIIINILLVSAFLLNLVFAFIIIFMERRTANSIWAWLLVLVFLPLVGFILYLLL GRQIQREHIFKLAKEDKVGLEMIVDEQLEALKKQDFSKGNHQIVKFKEMVQMLLYNNAAF LTTDNDLTIYTDGHQKFDDLINDIRHAQSYIHIQYYIIHSDNLGKQLLHELEKKAEEGIE VKMLYDDMGSRDLRKKDLKKFRQKGGHAESFFPSKLPLINLRMNNRNHRKIVVIDGTIGY VGGFNVGDEYIGKSKKFGYWRDTHLRIKGDAVNALQLRFILDWNSQSTRDNLTYESRYFP DVDSGGTIGIQIASSGPDEDWEQIKYGYLKMISSAKESIYIQSPYFIPDQAFLDSIKIAA LGGVDVNIMVPNKRDHPFVYWATLKNVASLLEAGVNVYHYDNGFLHSKTLVIDDEVASVG TANMDNRSFTLNFEVNAFIYDEGVARSLKQAFINDMKLSNKLTSEEYAKRNLLVKFKEGI SQLLSPIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls2 |
Synonyms | cls2; SERP1695; Cardiolipin synthase 2; CL synthase 2 |
UniProt ID | Q5HMD3 |
◆ Native Proteins | ||
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK4-5034HCL | Recombinant Human KCNK4 293 Cell Lysate | +Inquiry |
RPS14-2173HCL | Recombinant Human RPS14 293 Cell Lysate | +Inquiry |
DMRTC2-6897HCL | Recombinant Human DMRTC2 293 Cell Lysate | +Inquiry |
EGR3-243HCL | Recombinant Human EGR3 lysate | +Inquiry |
TTC23L-685HCL | Recombinant Human TTC23L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cls2 Products
Required fields are marked with *
My Review for All cls2 Products
Required fields are marked with *
0
Inquiry Basket