Recombinant Full Length Oryza Sativa Subsp. Indica Magnesium Transporter Mrs2-F(Mrs2-F) Protein, His-Tagged
Cat.No. : | RFL942OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Magnesium transporter MRS2-F(MRS2-F) Protein (A2WY50) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MRPSAAAGGGGGGGGRRKAAAAAAAASREWLVVPASGQARVEEAGKHAVMARTGLPARDL RVLDPLLSYPSTILGRERAIVVNLERVKAVITAAEVLLPNSKDPAFASFVCDLQARVLAS SSDQAAEFTDMEGESSAVTSPFPALTSTTPNELEMTNKNSNVVGGMTHSNSMPTLTAAKD GNTKVLPFEFRALEVCLESACRSLEEETSTLEQEAYPALDELTSKISTLNLERVRQIKSR LVAISGRVQKVRDELEHLLDDEMDMAEMYLTEKLTRQEISETSSRVEVDDPSQLEVDRDE DYRSEADVSNGTFIGYKPHIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLD DKQNQLLQMGVMLSTATVVITAGVAVVGLFGMNIGISLYADPTNEEEKRASNMKFWETTL GTIAGCTVMYIVAMGWGKRSGLLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-F |
Synonyms | MRS2-F; OsI_04855; Magnesium transporter MRS2-F |
UniProt ID | A2WY50 |
◆ Recombinant Proteins | ||
ITGB6-253H | Recombinant Human ITGB6 Protein, His-tagged | +Inquiry |
RFL36603TF | Recombinant Full Length Thioalkalivibrio Sp. Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
HSPA14-2943R | Recombinant Rat HSPA14 Protein | +Inquiry |
SH-RS03800-5435S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS03800 protein, His-tagged | +Inquiry |
ZNF260-10406M | Recombinant Mouse ZNF260 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
IgG-341D | Native Dog IgG | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX2-2107HCL | Recombinant Human RUNX2 293 Cell Lysate | +Inquiry |
GTF2IRD1-5692HCL | Recombinant Human GTF2IRD1 293 Cell Lysate | +Inquiry |
SPG21-454MCL | Recombinant Mouse SPG21 cell lysate | +Inquiry |
PPP1R15A-2943HCL | Recombinant Human PPP1R15A 293 Cell Lysate | +Inquiry |
AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-F Products
Required fields are marked with *
My Review for All MRS2-F Products
Required fields are marked with *
0
Inquiry Basket