Recombinant Full Length Staphylococcus Aureus Upf0754 Membrane Protein Sas1767(Sas1767) Protein, His-Tagged
Cat.No. : | RFL22609SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0754 membrane protein SAS1767(SAS1767) Protein (Q6G889) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFNEKGKLFGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAS1767 |
Synonyms | SAS1767; UPF0754 membrane protein SAS1767 |
UniProt ID | Q6G889 |
◆ Recombinant Proteins | ||
Mrm3-4143M | Recombinant Mouse Mrm3 Protein, Myc/DDK-tagged | +Inquiry |
TNFSF13B-4523H | Active Recombinant Human TNFSF13B protein, hFc-tagged | +Inquiry |
Toxin-5082V | Recombinant Vaejovis smithi Toxin protein, His&Myc-tagged | +Inquiry |
HCVgp1-129H | Recombinant Hepatitis C Virus HCVgp1 protein | +Inquiry |
Hdac10-3367M | Recombinant Mouse Hdac10 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Fxa-66R | Native Rat Factor Ixa | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
SAA-152H | Native Human Serum Amyloid A Protein | +Inquiry |
F2-647P | Native Pig F2 | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB3-1118HCL | Recombinant Human TGFB3 293 Cell Lysate | +Inquiry |
GATA3-6011HCL | Recombinant Human GATA3 293 Cell Lysate | +Inquiry |
RPL18A-2219HCL | Recombinant Human RPL18A 293 Cell Lysate | +Inquiry |
PAX5-3416HCL | Recombinant Human PAX5 293 Cell Lysate | +Inquiry |
Sol8-1668HCL | Sol8 (mouse myoblast) whole cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAS1767 Products
Required fields are marked with *
My Review for All SAS1767 Products
Required fields are marked with *
0
Inquiry Basket