Recombinant Full Length Staphylococcus Aureus Upf0421 Protein Sav1889(Sav1889) Protein, His-Tagged
Cat.No. : | RFL11031SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0421 protein SAV1889(SAV1889) Protein (Q7A2R3) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGTFKREDDSVETLRSTIKAL EISGENQIKSHILYEVLMIYRLLDSRYA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAV1889 |
Synonyms | SAV1889; UPF0421 protein SAV1889 |
UniProt ID | Q7A2R3 |
◆ Recombinant Proteins | ||
RFL32844MF | Recombinant Full Length Mouse P2Y Purinoceptor 2(P2Ry2) Protein, His-Tagged | +Inquiry |
KDM5C-6642Z | Recombinant Zebrafish KDM5C | +Inquiry |
VCAM1-30923TH | Recombinant Human VCAM1 Protein, His-tagged | +Inquiry |
TMEM120A-6113R | Recombinant Rat TMEM120A Protein | +Inquiry |
JAKMIP2-2150R | Recombinant Rhesus Macaque JAKMIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Factor B-60H | Native Human Factor B | +Inquiry |
Lectin-1749G | Active Native Galanthus Nivalis Lectin Protein | +Inquiry |
Thrombin-22H | Active Native Human Thrombin Protein | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXM1-6153HCL | Recombinant Human FOXM1 293 Cell Lysate | +Inquiry |
C20orf166-8123HCL | Recombinant Human C20orf166 293 Cell Lysate | +Inquiry |
C3orf27-245HCL | Recombinant Human C3orf27 cell lysate | +Inquiry |
ANXA8-1023HCL | Recombinant Human ANXA8 cell lysate | +Inquiry |
HSD17B2-5375HCL | Recombinant Human HSD17B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAV1889 Products
Required fields are marked with *
My Review for All SAV1889 Products
Required fields are marked with *
0
Inquiry Basket