Recombinant Full Length Staphylococcus Aureus Upf0421 Protein Sas1811(Sas1811) Protein, His-Tagged
Cat.No. : | RFL6632SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0421 protein SAS1811(SAS1811) Protein (Q6G845) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGSFKREDDSVETLRSTIKAL EISGENQIKSHILYEVLMIYRLLDSRYA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAS1811 |
Synonyms | SAS1811; UPF0421 protein SAS1811 |
UniProt ID | Q6G845 |
◆ Recombinant Proteins | ||
ADAP1-3615H | Recombinant Human ADAP1, His-tagged | +Inquiry |
FAM134B-2219R | Recombinant Rat FAM134B Protein | +Inquiry |
EFNB2-6870H | Recombinant Human Ephrin-B2, His-tagged | +Inquiry |
IGF1-0242H | Active Recombinant Human IGF1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL12A-1637Z | Recombinant Zebrafish IL12A | +Inquiry |
◆ Native Proteins | ||
CDA016 | Native Hepatitis B Surface Ag protein | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
VLDL-252H | Native Human Very Low Density Lipoprotein | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
Plg-5356M | Native Mouse Plg protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINF2-2445HCL | Recombinant Human SERPINF2 cell lysate | +Inquiry |
TNFSF13B-2025HCL | Recombinant Human TNFSF13B cell lysate | +Inquiry |
TAS1R3-1247HCL | Recombinant Human TAS1R3 293 Cell Lysate | +Inquiry |
FXYD4-6099HCL | Recombinant Human FXYD4 293 Cell Lysate | +Inquiry |
LURAP1L-139HCL | Recombinant Human LURAP1L lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAS1811 Products
Required fields are marked with *
My Review for All SAS1811 Products
Required fields are marked with *
0
Inquiry Basket