Recombinant Full Length Staphylococcus Aureus Upf0421 Protein Sacol1947(Sacol1947) Protein, His-Tagged
Cat.No. : | RFL36134SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0421 protein SACOL1947(SACOL1947) Protein (Q5HEN5) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MNDQWYKHLIGARTIKTGIAIFLTAVFCMALDLTPIYAILTAVVTIEPTAKASLIKGYRR LPATVIGAGFAVLFTYLFGDQSPFTYALSATFTILFCTKLKLQVGTNVAVLTSLAMIPGI HDAYIFNFLSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKTDALMYKLFYNRCQEL ILSRLQSDKSEKAYKNIFNLNNQVETLISYQRDELSYHKKKECDWKLLNQLTKRAYTNRL FITHLSNIIYLPKNTRVNFSGDEKMALLKISSSIKDIFYDGSFKREDDSVETLRSTIKAL EISGENQIKSHILYEVLMIYRLLDSRYA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SACOL1947 |
Synonyms | SACOL1947; UPF0421 protein SACOL1947 |
UniProt ID | Q5HEN5 |
◆ Recombinant Proteins | ||
RFL22716BF | Recombinant Full Length Bovine Tricarboxylate Transport Protein, Mitochondrial(Slc25A1) Protein, His-Tagged | +Inquiry |
Serpina12-2441M | Recombinant Mouse Serpina12, FLAG-tagged | +Inquiry |
FAM124B-5482M | Recombinant Mouse FAM124B Protein | +Inquiry |
GABRG2-2996H | Recombinant Human GABRG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAZ-1227H | Recombinant Human TAZ protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1840S | Active Native Sambucus Nigra Lectin Protein, Cy5 labeled | +Inquiry |
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
Lectin-1731R | Active Native Ricinus Communis Agglutinin I Protein, Rhodamine labeled | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
Thrombin-21H | Active Native Cattle Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCP1B-7047HCL | Recombinant Human DCP1B 293 Cell Lysate | +Inquiry |
PRR20A-507HCL | Recombinant Human PRR20A lysate | +Inquiry |
CLEC14A-2579MCL | Recombinant Mouse CLEC14A cell lysate | +Inquiry |
SFTPD-2144HCL | Recombinant Human SFTPD cell lysate | +Inquiry |
TMEM204-970HCL | Recombinant Human TMEM204 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SACOL1947 Products
Required fields are marked with *
My Review for All SACOL1947 Products
Required fields are marked with *
0
Inquiry Basket