Recombinant Full Length Staphylococcus Aureus Upf0397 Protein Sahv_2669 (Sahv_2669) Protein, His-Tagged
Cat.No. : | RFL5306SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0397 protein SAHV_2669 (SAHV_2669) Protein (A7X777) (1-184aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-184) |
Form : | Lyophilized powder |
AA Sequence : | MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGLFSRKSMIYFNIGQII ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS LRKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAHV_2669 |
Synonyms | SAHV_2669; UPF0397 protein SAHV_2669 |
UniProt ID | A7X777 |
◆ Recombinant Proteins | ||
Bst2-3534M | Recombinant Mouse Bst2 protein, hFc-tagged | +Inquiry |
TNFSF10-5949C | Recombinant Chicken TNFSF10 | +Inquiry |
CD27-556H | Recombinant Human CD27, His tagged | +Inquiry |
C10orf54-8589HAF555 | Recombinant Human C10orf54 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Zeb2-1848M | Recombinant Mouse Zeb2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
PLG-252H | Active Native Human Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G6-3139HCL | Recombinant Human PLA2G6 293 Cell Lysate | +Inquiry |
ZNF167-1990HCL | Recombinant Human ZNF167 cell lysate | +Inquiry |
CLC-7479HCL | Recombinant Human CLC 293 Cell Lysate | +Inquiry |
NDUFS6-1179HCL | Recombinant Human NDUFS6 cell lysate | +Inquiry |
Heart-431S | Sheep Heart Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAHV_2669 Products
Required fields are marked with *
My Review for All SAHV_2669 Products
Required fields are marked with *
0
Inquiry Basket