Recombinant Full Length Staphylococcus Aureus Upf0365 Protein Sacol1630(Sacol1630) Protein, His-Tagged
Cat.No. : | RFL1448SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0365 protein SACOL1630(SACOL1630) Protein (Q5HFI7) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SACOL1630 |
Synonyms | floA; SACOL1630; Flotillin-like protein FloA |
UniProt ID | Q5HFI7 |
◆ Native Proteins | ||
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
CGB-359H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B12-818HCL | Recombinant Human HSD17B12 cell lysate | +Inquiry |
PRRT2-1420HCL | Recombinant Human PRRT2 cell lysate | +Inquiry |
IL12A&IL27B-853HCL | Recombinant Human IL12A&IL27B cell lysate | +Inquiry |
MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
FANCG-6331HCL | Recombinant Human FANCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SACOL1630 Products
Required fields are marked with *
My Review for All SACOL1630 Products
Required fields are marked with *
0
Inquiry Basket