Recombinant Full Length Staphylococcus Aureus Upf0365 Protein Sab1445C(Sab1445C) Protein, His-Tagged
Cat.No. : | RFL15430SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0365 protein SAB1445c(SAB1445c) Protein (Q2YT06) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAB1445c |
Synonyms | floA; SAB1445c; Flotillin-like protein FloA |
UniProt ID | Q2YT06 |
◆ Recombinant Proteins | ||
FGF12-127H | Recombinant Human Fibroblast Growth Factor 12, His-tagged | +Inquiry |
INPP5E-5105H | Recombinant Human INPP5E Protein, GST-tagged | +Inquiry |
RFL18863CF | Recombinant Full Length Chlorobium Tepidum Cytochrome C(Pscc) Protein, His-Tagged | +Inquiry |
PROCR-568H | Recombinant Human PROCR Protein, GST-His-tagged | +Inquiry |
TCEB3-9076M | Recombinant Mouse TCEB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C3b-03M | Native Monkey C3b Protein | +Inquiry |
H3N20194-213I | Native H3N2 (A/Kiev/301/94) H3N20194 protein | +Inquiry |
Collagen Type I-48H | Native Human tendon collagen type I | +Inquiry |
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRCP-2888HCL | Recombinant Human PRCP 293 Cell Lysate | +Inquiry |
ING3-5207HCL | Recombinant Human ING3 293 Cell Lysate | +Inquiry |
RPA2-2242HCL | Recombinant Human RPA2 293 Cell Lysate | +Inquiry |
GREM2-5752HCL | Recombinant Human GREM2 293 Cell Lysate | +Inquiry |
TCEANC-1090HCL | Recombinant Human TCEANC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAB1445c Products
Required fields are marked with *
My Review for All SAB1445c Products
Required fields are marked with *
0
Inquiry Basket