Recombinant Full Length Staphylococcus Aureus Upf0316 Protein Sav1911 (Sav1911) Protein, His-Tagged
Cat.No. : | RFL17421SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0316 protein SAV1911 (SAV1911) Protein (P61543) (1-200aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-200) |
Form : | Lyophilized powder |
AA Sequence : | MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAV1911 |
Synonyms | SAV1911; UPF0316 protein SAV1911 |
UniProt ID | P61543 |
◆ Recombinant Proteins | ||
PVALB6-11614Z | Recombinant Zebrafish PVALB6 | +Inquiry |
V2RH14-5393Z | Recombinant Zebrafish V2RH14 | +Inquiry |
NECTIN1-1540R | Recombinant Rhesus Monkey NECTIN1 Protein, hIgG4-tagged | +Inquiry |
AGPS-219R | Recombinant Rat AGPS Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGLEC7-0689H | Active Recombinant Human SIGLEC7 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
CP-1767H | Native Human CP Protein | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMPR1B-464HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
DGKB-6958HCL | Recombinant Human DGKB 293 Cell Lysate | +Inquiry |
Placenta-387H | Human Placenta Membrane Lysate | +Inquiry |
SEPT9-1952HCL | Recombinant Human SEPT9 293 Cell Lysate | +Inquiry |
Testis-66H | Human Testis Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAV1911 Products
Required fields are marked with *
My Review for All SAV1911 Products
Required fields are marked with *
0
Inquiry Basket