Recombinant Full Length Staphylococcus Aureus Upf0060 Membrane Protein Sar2425(Sar2425) Protein, His-Tagged
Cat.No. : | RFL26100SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus UPF0060 membrane protein SAR2425(SAR2425) Protein (Q6GE96) (1-108aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-108) |
Form : | Lyophilized powder |
AA Sequence : | MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGVILMLYGVIATFQSFPSFGRV YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAR2425 |
Synonyms | SAR2425; UPF0060 membrane protein SAR2425 |
UniProt ID | Q6GE96 |
◆ Native Proteins | ||
Heparin-200S | Active Native Swine Heparin | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB25-1952HCL | Recombinant Human ZBTB25 cell lysate | +Inquiry |
ZNF143-142HCL | Recombinant Human ZNF143 293 Cell Lysate | +Inquiry |
MRPS36-4134HCL | Recombinant Human MRPS36 293 Cell Lysate | +Inquiry |
FAM222A-8323HCL | Recombinant Human C12orf34 293 Cell Lysate | +Inquiry |
SIL1-1838HCL | Recombinant Human SIL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SAR2425 Products
Required fields are marked with *
My Review for All SAR2425 Products
Required fields are marked with *
0
Inquiry Basket