Recombinant Full Length Staphylococcus Aureus Uncharacterized Sensor-Like Histidine Kinase Sausa300_0218(Sausa300_0218) Protein, His-Tagged
Cat.No. : | RFL15673SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAUSA300_0218(SAUSA300_0218) Protein (Q2FK46) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAUSA300_0218 |
Synonyms | hptS; SAUSA300_0218; Sensor protein kinase HptS |
UniProt ID | Q2FK46 |
◆ Recombinant Proteins | ||
MBL2-2636H | Recombinant Human MBL2 protein(21-248 aa), C-His-tagged | +Inquiry |
TUT7-6862HF | Recombinant Full Length Human TUT7 Protein, GST-tagged | +Inquiry |
AGAP3-541H | Recombinant Human AGAP3 Protein, MYC/DDK-tagged | +Inquiry |
TCEA2-2477H | Recombinant Human TCEA2 protein, His-tagged | +Inquiry |
Hmha1-1632M | Recombinant Mouse Hmha1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
S100BB-10H | Native Human S100BB | +Inquiry |
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
Complement C1-42H | Native Human Complement C1 | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTAP12-1-4854HCL | Recombinant Human KRTAP12 293 Cell Lysate | +Inquiry |
RNF20-1524HCL | Recombinant Human RNF20 cell lysate | +Inquiry |
LYSMD4-4581HCL | Recombinant Human LYSMD4 293 Cell Lysate | +Inquiry |
THEG-1098HCL | Recombinant Human THEG 293 Cell Lysate | +Inquiry |
C11orf48-8350HCL | Recombinant Human C11orf48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SAUSA300_0218 Products
Required fields are marked with *
My Review for All SAUSA300_0218 Products
Required fields are marked with *
0
Inquiry Basket