Recombinant Full Length Staphylococcus Aureus Uncharacterized Sensor-Like Histidine Kinase Sas0199(Sas0199) Protein, His-Tagged
Cat.No. : | RFL28196SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAS0199(SAS0199) Protein (Q6GCQ2) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRGLLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDSRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAS0199 |
Synonyms | hptS; SAS0199; Sensor protein kinase HptS |
UniProt ID | Q6GCQ2 |
◆ Recombinant Proteins | ||
Zdhhc2-7071M | Recombinant Mouse Zdhhc2 Protein, Myc/DDK-tagged | +Inquiry |
RORCB-8291Z | Recombinant Zebrafish RORCB | +Inquiry |
TRAK-3872S | Recombinant Staphylococcus aureus TRAK protein, His-tagged | +Inquiry |
RFL33981BF | Recombinant Full Length Bacillus Subtilis Choline Transport System Permease Protein Opubb(Opubb) Protein, His-Tagged | +Inquiry |
PKD2-6779M | Recombinant Mouse PKD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
TF-135R | Native Rabbit Transferrin | +Inquiry |
ALB-4783D | Native Dog Albumin | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STOML2-1391HCL | Recombinant Human STOML2 Cell Lysate | +Inquiry |
Spleen-146R | Rat Spleen Tissue Lysate | +Inquiry |
FRG1-667HCL | Recombinant Human FRG1 cell lysate | +Inquiry |
LOC554223-1019HCL | Recombinant Human LOC554223 cell lysate | +Inquiry |
Uterus-838M | Mini pig Uterus Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SAS0199 Products
Required fields are marked with *
My Review for All SAS0199 Products
Required fields are marked with *
0
Inquiry Basket