Recombinant Full Length Staphylococcus Aureus Uncharacterized Sensor-Like Histidine Kinase Saouhsc_00185(Saouhsc_00185) Protein, His-Tagged
Cat.No. : | RFL28020SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized sensor-like histidine kinase SAOUHSC_00185(SAOUHSC_00185) Protein (Q2G1E0) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAOUHSC_00185 |
Synonyms | hptS; SAOUHSC_00185; Sensor protein kinase HptS |
UniProt ID | Q2G1E0 |
◆ Recombinant Proteins | ||
RNF111-2333H | Recombinant Human RNF111, His-tagged | +Inquiry |
CD300LB-10941H | Recombinant Human CD300LB, GST-tagged | +Inquiry |
ASPH-506HFL | Recombinant Full Length Human ASPH Protein, C-Flag-tagged | +Inquiry |
UCHL5IP-3573H | Recombinant Human UCHL5IP, His-tagged | +Inquiry |
F3-18H | Recombinant Human Tissue Factor, Non-Lipidated | +Inquiry |
◆ Native Proteins | ||
Fgg -69R | Native Rat Fibrinogen | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
TSH-10B | Active Native Bovine TSH Protein | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFT88-5270HCL | Recombinant Human IFT88 293 Cell Lysate | +Inquiry |
Kidney-261H | Human Kidney Lupus Lysate | +Inquiry |
PDE5A-3348HCL | Recombinant Human PDE5A 293 Cell Lysate | +Inquiry |
FHL2-6223HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
NR5A1-3705HCL | Recombinant Human NR5A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAOUHSC_00185 Products
Required fields are marked with *
My Review for All SAOUHSC_00185 Products
Required fields are marked with *
0
Inquiry Basket