Recombinant Full Length Staphylococcus Aureus Uncharacterized Membrane Protein Sar0800(Sar0800) Protein, His-Tagged
Cat.No. : | RFL16970SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized membrane protein SAR0800(SAR0800) Protein (Q6GIP5) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAR0800 |
Synonyms | SAR0800; Uncharacterized membrane protein SAR0800 |
UniProt ID | Q6GIP5 |
◆ Recombinant Proteins | ||
SMC1B-2809H | Recombinant Human SMC1B, His-tagged | +Inquiry |
AGRN-12H | Recombinant Human AGRN protein, His/T7-tagged | +Inquiry |
VILL-3662H | Recombinant Human VILL, His-tagged | +Inquiry |
FAM24A-3049M | Recombinant Mouse FAM24A Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFA5-551HFL | Recombinant Full Length Human DEFA5 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
IgM-04T | Native Toxoplasma gondii IgM antigen, RH strain | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
ECV-309S | Native Snake ECV- PROTHROMBIN ACTIVATOR | +Inquiry |
MG-41H | Active Native Human MG | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF70-23HCL | Recombinant Human ZNF70 293 Cell Lysate | +Inquiry |
SOX17-1562HCL | Recombinant Human SOX17 293 Cell Lysate | +Inquiry |
CENPN-7579HCL | Recombinant Human CENPN 293 Cell Lysate | +Inquiry |
HNF1A-5461HCL | Recombinant Human HNF1A 293 Cell Lysate | +Inquiry |
KIF1B-4951HCL | Recombinant Human KIF1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAR0800 Products
Required fields are marked with *
My Review for All SAR0800 Products
Required fields are marked with *
0
Inquiry Basket