Recombinant Full Length Staphylococcus Aureus Uncharacterized Membrane Protein Sab0698C(Sab0698C) Protein, His-Tagged
Cat.No. : | RFL433SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Uncharacterized membrane protein SAB0698c(SAB0698c) Protein (Q2YSF9) (1-356aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-356) |
Form : | Lyophilized powder |
AA Sequence : | MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAB0698c |
Synonyms | SAB0698c; Uncharacterized membrane protein SAB0698c |
UniProt ID | Q2YSF9 |
◆ Recombinant Proteins | ||
DOT1L-120H | Recombinant Human DOT1 like histone lysine methyltransferase Protein, His&StrepII tagged | +Inquiry |
RBFOX2-13984M | Recombinant Mouse RBFOX2 Protein | +Inquiry |
LRRC45-6020HF | Recombinant Full Length Human LRRC45 Protein, GST-tagged | +Inquiry |
CXCL8-231C | Active Recombinant Human CXCL8 Protein | +Inquiry |
RFL15589RF | Recombinant Full Length Rat Mitofusin-2(Mfn2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C16orf5-8254HCL | Recombinant Human C16orf5 293 Cell Lysate | +Inquiry |
METTL5-1083HCL | Recombinant Human METTL5 cell lysate | +Inquiry |
MAP1LC3C-1053HCL | Recombinant Human MAP1LC3C cell lysate | +Inquiry |
DPY19L3-234HCL | Recombinant Human DPY19L3 lysate | +Inquiry |
RNF24-2280HCL | Recombinant Human RNF24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAB0698c Products
Required fields are marked with *
My Review for All SAB0698c Products
Required fields are marked with *
0
Inquiry Basket