Recombinant Full Length Staphylococcus Aureus Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL5445SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Sensor protein vraS(vraS) Protein (Q9KWK8) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MNHYNRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; SAHV_1870; Sensor protein VraS |
UniProt ID | Q9KWK8 |
◆ Recombinant Proteins | ||
Serpina1-3479R | Recombinant Rat Serpina1 protein, His-SUMO-tagged | +Inquiry |
PSMB8F-2529Z | Recombinant Zebrafish PSMB8F | +Inquiry |
MTAP-29502TH | Recombinant Human MTAP, GST-tagged | +Inquiry |
GHR-555H | Recombinant Human GHR Protein, Biotinylated | +Inquiry |
DCUN1D5-1805R | Recombinant Rat DCUN1D5 Protein | +Inquiry |
◆ Native Proteins | ||
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
IgG2A-015M | Native Mouse IgG2A Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPM-2515HCL | Recombinant Human CPM cell lysate | +Inquiry |
Bladder-505D | Dog Bladder Lysate, Total Protein | +Inquiry |
ALDH3A1-542HCL | Recombinant Human ALDH3A1 cell lysate | +Inquiry |
MAGEB3-4544HCL | Recombinant Human MAGEB3 293 Cell Lysate | +Inquiry |
Raji-01HL | Human Raji lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket