Recombinant Full Length Staphylococcus Aureus Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL26045SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Sensor protein vraS(vraS) Protein (Q6G849) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; SAS1807; Sensor protein VraS |
UniProt ID | Q6G849 |
◆ Native Proteins | ||
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
FGB-6H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRD3-178HCL | Recombinant Human BRD3 cell lysate | +Inquiry |
NAT8L-3960HCL | Recombinant Human NAT8L 293 Cell Lysate | +Inquiry |
Persimmon-704P | Persimmon Lysate, Total Protein | +Inquiry |
ALCAM-828RCL | Recombinant Rat ALCAM cell lysate | +Inquiry |
FAM177A1-6401HCL | Recombinant Human FAM177A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket