Recombinant Full Length Staphylococcus Aureus Sensor Protein Vras(Vras) Protein, His-Tagged
Cat.No. : | RFL12754SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Sensor protein vraS(vraS) Protein (Q5HEN9) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vraS |
Synonyms | vraS; SACOL1943; Sensor protein VraS |
UniProt ID | Q5HEN9 |
◆ Recombinant Proteins | ||
CRP-1816H | Recombinant Human CRP Protein (Phe17-Pro224), N-His tagged | +Inquiry |
CXCL2-4105M | Recombinant Mouse CXCL2 Protein | +Inquiry |
YQEM-1656B | Recombinant Bacillus subtilis YQEM protein, His-tagged | +Inquiry |
DSCR9-2887H | Recombinant Human DSCR9 Protein, GST-tagged | +Inquiry |
ALKBH3-2470HF | Recombinant Full Length Human ALKBH3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
Ferritin-12H | Native Human Ferritin Protein, Tag Free | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Bladder-81M | Mouse Bladder Tissue Lysate | +Inquiry |
ENPP5-1509HCL | Recombinant Human ENPP5 cell lysate | +Inquiry |
ZNF174-136HCL | Recombinant Human ZNF174 293 Cell Lysate | +Inquiry |
MCPT1-2749MCL | Recombinant Mouse MCPT1 cell lysate | +Inquiry |
ZNF180-132HCL | Recombinant Human ZNF180 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vraS Products
Required fields are marked with *
My Review for All vraS Products
Required fields are marked with *
0
Inquiry Basket