Recombinant Full Length Staphylococcus Aureus Putative Zinc Metalloprotease Sas1196(Sas1196) Protein, His-Tagged
Cat.No. : | RFL1889SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative zinc metalloprotease SAS1196(SAS1196) Protein (Q6G9V1) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MSYLVTIIAFIIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIR LLPVGGYVRMAGDGLEEPPVEPGMNVKIKLNEENEITHIILDDHHKFQQIEAIEVKKCDF KDDLFIEGITAYDNERHHFKIARKSFFVENGSLVQIAPRDRQFAHKKPWPKFLTLFAGPL FNFILALVLFIGLAYYQGTPTSTVEQVADKYPAQQAGLQKGDKIVQIGKYKISEFDDVDK ALDKVKDNKTTVKFERDGKTKSVELTPKKTERKLTKVSSETKYVLGFQPASERTLFKPIV YGFESFLKGSTLIFTAVVGMLASIFTGGFSFDMLNGPVGIYHNVDSVVKAGIISLIGYTA LLSVNLGIMNLIPIPALDGGRILFVIYEAIFRKPVNKKAETTIIAIGAIFMVVIMILVTW NDIRRYFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAS1196 |
Synonyms | SAS1196; Putative zinc metalloprotease SAS1196 |
UniProt ID | Q6G9V1 |
◆ Recombinant Proteins | ||
RFL20934SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Sna3(Sna3) Protein, His-Tagged | +Inquiry |
EMP1-1460HFL | Recombinant Full Length Human EMP1 Protein, C-Flag-tagged | +Inquiry |
Angel1-1624M | Recombinant Mouse Angel1 Protein, Myc/DDK-tagged | +Inquiry |
Tcea3-6329M | Recombinant Mouse Tcea3 Protein, Myc/DDK-tagged | +Inquiry |
F13A1-2497H | Recombinant Human F13A1 protein(431-520 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
Ferritin-20M | Native Mouse Ferritin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFHA2-534HCL | Recombinant Human EFHA2 cell lysate | +Inquiry |
SUDS3-1363HCL | Recombinant Human SUDS3 293 Cell Lysate | +Inquiry |
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
PPFIBP1-2979HCL | Recombinant Human PPFIBP1 293 Cell Lysate | +Inquiry |
MCAM-1713MCL | Recombinant Mouse MCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAS1196 Products
Required fields are marked with *
My Review for All SAS1196 Products
Required fields are marked with *
0
Inquiry Basket