Recombinant Full Length Staphylococcus Aureus Putative Multidrug Export Atp-Binding/Permease Protein Sausa300_1847(Sausa300_1847) Protein, His-Tagged
Cat.No. : | RFL15533SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative multidrug export ATP-binding/permease protein SAUSA300_1847(SAUSA300_1847) Protein (Q2FFM9) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAUSA300_1847 |
Synonyms | SAUSA300_1847; Putative multidrug export ATP-binding/permease protein SAUSA300_1847 |
UniProt ID | Q2FFM9 |
◆ Recombinant Proteins | ||
Il19-1668R | Recombinant Rat Il19 Protein, His-tagged | +Inquiry |
EIF3HA-1098Z | Recombinant Zebrafish EIF3HA | +Inquiry |
PCSK9-3334R | Recombinant Rhesus monkey PCSK9 Protein, His-tagged | +Inquiry |
CDCA8-11027H | Recombinant Human CDCA8, His-tagged | +Inquiry |
Relb-5457M | Recombinant Mouse Relb Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Chitosan-003C | Native Crawfish Chitosan Water Soluble | +Inquiry |
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
C3-8391H | Native Human C3 | +Inquiry |
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK3-327HCL | Recombinant Human CDK3 cell lysate | +Inquiry |
FCHSD2-6277HCL | Recombinant Human FCHSD2 293 Cell Lysate | +Inquiry |
ZNF554-53HCL | Recombinant Human ZNF554 293 Cell Lysate | +Inquiry |
EPHB3-2131MCL | Recombinant Mouse EPHB3 cell lysate | +Inquiry |
LSM11-4611HCL | Recombinant Human LSM11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAUSA300_1847 Products
Required fields are marked with *
My Review for All SAUSA300_1847 Products
Required fields are marked with *
0
Inquiry Basket