Recombinant Full Length Staphylococcus Aureus Putative Multidrug Export Atp-Binding/Permease Protein Sar1956(Sar1956) Protein, His-Tagged
Cat.No. : | RFL16193SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative multidrug export ATP-binding/permease protein SAR1956(SAR1956) Protein (Q6GFJ1) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLT IAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQV ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYV FFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKH TRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVAS FTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDI NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLV QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSG GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTIT HADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAR1956 |
Synonyms | SAR1956; Putative multidrug export ATP-binding/permease protein SAR1956 |
UniProt ID | Q6GFJ1 |
◆ Recombinant Proteins | ||
GERAA-0531B | Recombinant Bacillus subtilis GERAA protein, His-tagged | +Inquiry |
RFL21153DF | Recombinant Full Length Drosophila Melanogaster Er Lumen Protein Retaining Receptor(Kdelr) Protein, His-Tagged | +Inquiry |
TMEM219-4589H | Recombinant Human TMEM219 protein, His&Myc-tagged | +Inquiry |
ALPP-2511H | Recombinant Human ALPP protein, His-tagged | +Inquiry |
BDKRB2-2540H | Recombinant Human BDKRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDH5-8342H | Native Human LDH5 | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
AFP-412H | Native Human AFP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GGA1-698HCL | Recombinant Human GGA1 cell lysate | +Inquiry |
PAK4-3455HCL | Recombinant Human PAK4 293 Cell Lysate | +Inquiry |
MSH4-4119HCL | Recombinant Human MSH4 293 Cell Lysate | +Inquiry |
GAP43-1911HCL | Recombinant Human GAP43 cell lysate | +Inquiry |
FAM78B-6348HCL | Recombinant Human FAM78B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SAR1956 Products
Required fields are marked with *
My Review for All SAR1956 Products
Required fields are marked with *
0
Inquiry Basket