Recombinant Human ALPP protein, His-tagged

• Cat.No.: ALPP-2511H
• Product Overview: Recombinant Human ALPP protein(P05187)(117-447aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.9 kDa
• Protein length: 117-447aa
• AA Sequence: TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ALPP alkaline phosphatase, placental [ Homo sapiens ]
• Official Symbol: ALPP
• Synonyms: ALPP; alkaline phosphatase, placental; alkaline phosphatase, placental (Regan isozyme); alkaline phosphatase, placental type; Regan isozyme; PLAP-1; glycerophosphatase; alkaline phosphomonoesterase; placental alkaline phosphatase 1; alkaline phosphatase Regan isozyme; ALP; PALP; PLAP; FLJ61142
• Gene ID: 250
• mRNA Refseq: NM_001632
• Protein Refseq: NP_001623
• MIM: 171800
• UniProt ID: P05187