Recombinant Human ALPP protein, His-tagged
Cat.No. : | ALPP-2511H |
Product Overview : | Recombinant Human ALPP protein(P05187)(117-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 117-447aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.9 kDa |
AA Sequence : | TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ALPP alkaline phosphatase, placental [ Homo sapiens ] |
Official Symbol | ALPP |
Synonyms | ALPP; alkaline phosphatase, placental; alkaline phosphatase, placental (Regan isozyme); alkaline phosphatase, placental type; Regan isozyme; PLAP-1; glycerophosphatase; alkaline phosphomonoesterase; placental alkaline phosphatase 1; alkaline phosphatase Regan isozyme; ALP; PALP; PLAP; FLJ61142; |
Gene ID | 250 |
mRNA Refseq | NM_001632 |
Protein Refseq | NP_001623 |
MIM | 171800 |
UniProt ID | P05187 |
◆ Recombinant Proteins | ||
ALPP-221H | Recombinant Human ALPP protein, T7/His-tagged | +Inquiry |
ALPP-30162H | Recombinant Human ALPP protein, GST-tagged | +Inquiry |
ALPP-67H | Recombinant Human ALPP Protein, His-tagged | +Inquiry |
ALPP-124H | Recombinant Human ALPP Protein, His-tagged | +Inquiry |
ALPP-150HFL | Recombinant Full Length Human ALPP Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
ALPP-8347H | Native Human ALPP | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPP-8893HCL | Recombinant Human ALPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALPP Products
Required fields are marked with *
My Review for All ALPP Products
Required fields are marked with *
0
Inquiry Basket