Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhf2(Mnhf2) Protein, His-Tagged
Cat.No. : | RFL7337SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative antiporter subunit mnhF2(mnhF2) Protein (Q6GBK2) (1-100aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-100) |
Form : | Lyophilized powder |
AA Sequence : | MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhF2 |
Synonyms | mnhF2; mrpF2; SAS0594; Putative antiporter subunit mnhF2; Mrp complex subunit F2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2 |
UniProt ID | Q6GBK2 |
◆ Recombinant Proteins | ||
HUWE1-4016H | Recombinant Human HUWE1 protein(4005-4374aa), His&Myc-tagged | +Inquiry |
FAM199X-2193H | Recombinant Human FAM199X Protein, GST-tagged | +Inquiry |
Tgm2-6818M | Recombinant Mouse Tgm2 Protein (Ala2-Ala686), C-His tagged | +Inquiry |
MAT2B-3596R | Recombinant Rat MAT2B Protein | +Inquiry |
GLRA2-1872R | Recombinant Rhesus monkey GLRA2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LTF-27590TH | Native Human LTF | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
FABP-174M | Native Cynomolgus Monkey Fatty acid Binding Protein | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM133B-6427HCL | Recombinant Human FAM133B 293 Cell Lysate | +Inquiry |
AK5-8943HCL | Recombinant Human AK5 293 Cell Lysate | +Inquiry |
FAM3D-1947HCL | Recombinant Human FAM3D cell lysate | +Inquiry |
HNRNPC-5449HCL | Recombinant Human HNRNPC 293 Cell Lysate | +Inquiry |
THOC6-1092HCL | Recombinant Human THOC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhF2 Products
Required fields are marked with *
My Review for All mnhF2 Products
Required fields are marked with *
0
Inquiry Basket