Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhf2(Mnhf2) Protein, His-Tagged
Cat.No. : | RFL35496SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative antiporter subunit mnhF2(mnhF2) Protein (A5IQI0) (1-100aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-100) |
Form : | Lyophilized powder |
AA Sequence : | MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhF2 |
Synonyms | mnhF2; mrpF2; SaurJH9_0650; Putative antiporter subunit mnhF2; Mrp complex subunit F2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2 |
UniProt ID | A5IQI0 |
◆ Recombinant Proteins | ||
ZNF575-850C | Recombinant Cynomolgus Monkey ZNF575 Protein, His (Fc)-Avi-tagged | +Inquiry |
SE0427-3119S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0427 protein, His-tagged | +Inquiry |
DOM3Z-1592R | Recombinant Rat DOM3Z Protein, His (Fc)-Avi-tagged | +Inquiry |
LCN5-3369R | Recombinant Rat LCN5 Protein | +Inquiry |
GM2506-3688M | Recombinant Mouse GM2506 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GNT6-001HCL | Recombinant Human B3GNT6 cell lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
DDO-7025HCL | Recombinant Human DDO 293 Cell Lysate | +Inquiry |
LMX1B-383HCL | Recombinant Human LMX1B lysate | +Inquiry |
TEK-1511MCL | Recombinant Mouse TEK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhF2 Products
Required fields are marked with *
My Review for All mnhF2 Products
Required fields are marked with *
0
Inquiry Basket