Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhe2(Mnhe2) Protein, His-Tagged
Cat.No. : | RFL33878SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Putative antiporter subunit mnhE2(mnhE2) Protein (Q8NXT0) (1-160aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-160) |
Form : | Lyophilized powder |
AA Sequence : | MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhE2 |
Synonyms | mnhE2; mrpE2; MW0589; Putative antiporter subunit mnhE2; Mrp complex subunit E2; Putative NADH-ubiquinone oxidoreductase subunit mnhE2 |
UniProt ID | Q8NXT0 |
◆ Recombinant Proteins | ||
CINP-27249TH | Recombinant Human CINP | +Inquiry |
RFL10441PF | Recombinant Full Length Pan Troglodytes Xk-Related Protein 7(Xkr7) Protein, His-Tagged | +Inquiry |
GATSL3-3491M | Recombinant Mouse GATSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC22A1-677H | Recombinant Human SLC22A1 Protein | +Inquiry |
GPAA1-1746R | Recombinant Rhesus Macaque GPAA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
Lectin-1836R | Native Ricinus Communis Ricin B Chain Protein | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pancreas-817H | Hamster Pancreas Membrane Lysate, Total Protein | +Inquiry |
UNC45A-500HCL | Recombinant Human UNC45A 293 Cell Lysate | +Inquiry |
ATP2C1-148HCL | Recombinant Human ATP2C1 cell lysate | +Inquiry |
SARS2-2060HCL | Recombinant Human SARS2 293 Cell Lysate | +Inquiry |
ALOX12-64HCL | Recombinant Human ALOX12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhE2 Products
Required fields are marked with *
My Review for All mnhE2 Products
Required fields are marked with *
0
Inquiry Basket