Recombinant Full Length Staphylococcus Aureus Protein Flp(Flp) Protein, His-Tagged
Cat.No. : | RFL26024SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Protein flp(flp) Protein (Q8NUZ4) (1-498aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-498) |
Form : | Lyophilized powder |
AA Sequence : | MTTKKLYFLSISIIILVAISIAIHITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDAVTNKNNRLNDVTRAIMGDEL HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTQYITDHWLKPLQMKHTTFKQTNYKSKHDA IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS STIGEPNANPYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK LVEHLNTQIVNHKRYSTVASILNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL LRRSKRIAVLSWLTLCLCIAIALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL FSTLIVILLFLHTKITKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flp |
Synonyms | flp; MW2365; Protein flp; FmtA-like protein |
UniProt ID | Q8NUZ4 |
◆ Native Proteins | ||
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVOL1-1263HCL | Recombinant Human OVOL1 cell lysate | +Inquiry |
RNF19A-2285HCL | Recombinant Human RNF19A 293 Cell Lysate | +Inquiry |
NPSR1-3728HCL | Recombinant Human NPSR1 293 Cell Lysate | +Inquiry |
C2C12-067MCL | Mouse C2C12 Whole Cell Lysate | +Inquiry |
CANT1-1597HCL | Recombinant Human CANT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All flp Products
Required fields are marked with *
My Review for All flp Products
Required fields are marked with *
0
Inquiry Basket