Recombinant Full Length Staphylococcus Aureus Protein Flp(Flp) Protein, His-Tagged
Cat.No. : | RFL9636SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Protein flp(flp) Protein (Q6G6M9) (1-498aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-498) |
Form : | Lyophilized powder |
AA Sequence : | MTTKKLYFLSISIIILVAISIAIHITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDAVTNKNNRLNDVTRAIMGDEL HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTQYITDHWLKPLQMKHTTFKQTNYKSKHDA IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK LVEHLNTQIVNHKRYSTVASILNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL LRRSKRIAVLSWLTLCLCIAIALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL FSTLIVILLFLHTKITKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flp |
Synonyms | flp; SAS2333; Protein flp; FmtA-like protein |
UniProt ID | Q6G6M9 |
◆ Recombinant Proteins | ||
GPR139-7145M | Recombinant Mouse GPR139 Protein | +Inquiry |
GCHFR-2490R | Recombinant Rat GCHFR Protein | +Inquiry |
RFL22134HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 1A(Htr1A) Protein, His-Tagged | +Inquiry |
RFL10392HF | Recombinant Full Length Human Transmembrane Protein 74(Tmem74) Protein, His-Tagged | +Inquiry |
TRPC-2932S | Recombinant Staphylococcus epidermidis ATCC 12228 TRPC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PR-01H | Native HIV1 PR Protein | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMA4-1643HCL | Recombinant Human SMA4 cell lysate | +Inquiry |
GOT2-302HCL | Recombinant Human GOT2 lysate | +Inquiry |
C1QTNF1-8139HCL | Recombinant Human C1QTNF1 293 Cell Lysate | +Inquiry |
SH3RF2-1863HCL | Recombinant Human SH3RF2 293 Cell Lysate | +Inquiry |
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All flp Products
Required fields are marked with *
My Review for All flp Products
Required fields are marked with *
0
Inquiry Basket