Recombinant Full Length Staphylococcus Aureus Protein Flp(Flp) Protein, His-Tagged
Cat.No. : | RFL20527SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Protein flp(flp) Protein (Q2FVH6) (1-498aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-498) |
Form : | Lyophilized powder |
AA Sequence : | MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTHAIMGDEL HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL FSTLIVILLFLHTKITKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flp |
Synonyms | flp; SAOUHSC_02736; Protein flp; FmtA-like protein |
UniProt ID | Q2FVH6 |
◆ Recombinant Proteins | ||
ACAD11-1158M | Recombinant Mouse ACAD11 Protein | +Inquiry |
UBR7-3563H | Recombinant Human UBR7 protein, His-tagged | +Inquiry |
SEMG1-7640H | Recombinant Human SEMG1, His-tagged | +Inquiry |
SULT3ST3-5262Z | Recombinant Zebrafish SULT3ST3 | +Inquiry |
RFL24318HF | Recombinant Full Length Halobacterium Salinarum Putative Cobalt Transport Protein Cbim(Cbim) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Ferritin-12H | Native Human Ferritin Protein, Tag Free | +Inquiry |
RNase-43B | Active Native Bovine Ribonuclease | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN10-362HCL | Recombinant Human CLDN10 cell lysate | +Inquiry |
SOSTDC1-1567HCL | Recombinant Human SOSTDC1 293 Cell Lysate | +Inquiry |
ARSE-38HCL | Recombinant Human ARSE lysate | +Inquiry |
Kidney-275H | Human Kidney Tumor Lysate | +Inquiry |
Ovary-351H | Human Ovary Cytoplasmic Tumor Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flp Products
Required fields are marked with *
My Review for All flp Products
Required fields are marked with *
0
Inquiry Basket