Recombinant Full Length Staphylococcus Aureus Probable Ctpa-Like Serine Protease(Sas1363) Protein, His-Tagged
Cat.No. : | RFL34159SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Probable CtpA-like serine protease(SAS1363) Protein (Q6G9E1) (1-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-496) |
Form : | Lyophilized powder |
AA Sequence : | MDDKQHTSSSDDERAEIATSNQDQETNSSKRVHLKRWQFISILIGTILITAVITVVAYIF INQKISGLNKTDQANLNKIENVYKILNSDYYKKQDSDKLSKAAIDGMVKELKDPYSEYLT KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN IKTIKIGLSALGYKVDNETTQFDQALENQVKAFQQANKLEVTGEFNKETNNKFTELLVEK ANKHDDVLDKLINILK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAS1363 |
Synonyms | SAS1363; Probable CtpA-like serine protease |
UniProt ID | Q6G9E1 |
◆ Recombinant Proteins | ||
GOT2-13399H | Recombinant Human GOT2, His-tagged | +Inquiry |
HES7-3521HF | Recombinant Full Length Human HES7 Protein, GST-tagged | +Inquiry |
COX7A1-1759H | Recombinant Human COX7A1 Protein, GST-tagged | +Inquiry |
ELMO3-1421H | Recombinant Human ELMO3 Protein, His-tagged | +Inquiry |
IRF6-8304M | Recombinant Mouse IRF6 Protein | +Inquiry |
◆ Native Proteins | ||
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLBP-596HCL | Recombinant Human SLBP lysate | +Inquiry |
LIMA1-4742HCL | Recombinant Human LIMA1 293 Cell Lysate | +Inquiry |
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
PCP2-3373HCL | Recombinant Human PCP2 293 Cell Lysate | +Inquiry |
BTG4-193HCL | Recombinant Human BTG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAS1363 Products
Required fields are marked with *
My Review for All SAS1363 Products
Required fields are marked with *
0
Inquiry Basket