Recombinant Full Length Staphylococcus Aureus Potassium-Transporting Atpase B Chain 2(Kdpb2) Protein, His-Tagged
Cat.No. : | RFL28879SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Potassium-transporting ATPase B chain 2(kdpB2) Protein (P63684) (1-675aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-675) |
Form : | Lyophilized powder |
AA Sequence : | MHHVNKYFNQTMVIEALKMSFYKLNPKQLIKNPIMFVVEVGMVLTLILICFPDIFGTSYL SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP FLGIKLIDMIVQFFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdpB2 |
Synonyms | kdpB2; SA1880; Potassium-transporting ATPase ATP-binding subunit 2; ATP phosphohydrolase [potassium-transporting] B chain 2; Potassium-binding and translocating subunit B 2; Potassium-translocating ATPase B chain 2 |
UniProt ID | P63684 |
◆ Recombinant Proteins | ||
NTRK2-2617H | Recombinant Human NTRK2 Protein (Cys32-His430), His tagged | +Inquiry |
BEX6-1019M | Recombinant Mouse BEX6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NECTIN4 -0241H | Active Recombinant Human NECTIN4 protein, His-tagged | +Inquiry |
IL5-214H | Recombinant Human IL5 | +Inquiry |
RPSN-3618S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 RPSN protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LH-839H | Active Native Human Luteinizing Hormone | +Inquiry |
Collagen-325H | Native Human Collagen Type I | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR91-328HCL | Recombinant Human WDR91 293 Cell Lysate | +Inquiry |
CAMLG-7872HCL | Recombinant Human CAMLG 293 Cell Lysate | +Inquiry |
FAM65B-6359HCL | Recombinant Human FAM65B 293 Cell Lysate | +Inquiry |
GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
ARFGAP1-8754HCL | Recombinant Human ARFGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All kdpB2 Products
Required fields are marked with *
My Review for All kdpB2 Products
Required fields are marked with *
0
Inquiry Basket