Recombinant Full Length Staphylococcus Aureus Potassium-Transporting Atpase B Chain 2(Kdpb2) Protein, His-Tagged
Cat.No. : | RFL27748SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Potassium-transporting ATPase B chain 2(kdpB2) Protein (P63683) (1-675aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-675) |
Form : | Lyophilized powder |
AA Sequence : | MHHVNKYFNQTMVIEALKMSFYKLNPKQLIKNPIMFVVEVGMVLTLILICFPDIFGTSYL SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP FLGIKLIDMIVQFFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdpB2 |
Synonyms | kdpB2; SAV2076; Potassium-transporting ATPase ATP-binding subunit 2; ATP phosphohydrolase [potassium-transporting] B chain 2; Potassium-binding and translocating subunit B 2; Potassium-translocating ATPase B chain 2 |
UniProt ID | P63683 |
◆ Recombinant Proteins | ||
PHLDA1-1699H | Recombinant Human PHLDA1 Protein, 6xHis-Tagged | +Inquiry |
SPON1-15918M | Recombinant Mouse SPON1 Protein | +Inquiry |
SH2D5-4002R | Recombinant Rhesus Macaque SH2D5 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMIGO2-9618H | Recombinant Human AMIGO2, His-tagged | +Inquiry |
CDYL2-1555M | Recombinant Mouse CDYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
LDL-407H | Native Human Low Density Lipoprotein, Acetylated, DiI labeled | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPX-2279MCL | Recombinant Mouse HPX cell lysate | +Inquiry |
LILRB2-1211HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
LYRM1-4586HCL | Recombinant Human LYRM1 293 Cell Lysate | +Inquiry |
NPM3-3736HCL | Recombinant Human NPM3 293 Cell Lysate | +Inquiry |
AMOT-8878HCL | Recombinant Human AMOT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kdpB2 Products
Required fields are marked with *
My Review for All kdpB2 Products
Required fields are marked with *
0
Inquiry Basket