Recombinant Full Length Staphylococcus Aureus Potassium-Transporting Atpase B Chain 1(Kdpb1) Protein, His-Tagged
Cat.No. : | RFL20554SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Potassium-transporting ATPase B chain 1(kdpB1) Protein (P0A007) (1-673aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-673) |
Form : | Lyophilized powder |
AA Sequence : | MAETTKIFESHLVKQALKDSVLKLYPVYMIKNPIMFVVEVGMLLALGLTIYPDLFHQESV SRLYVFSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKARRIKQDGSYEMIDA SDLKKGHIVRVATGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDFDNVIGGTSVA SDWLEVEITSEPGHSFLDKMIGLVEGATRKKTPNEIALFTLLMTLTIIFLVVILTMYPLA KFLNFNLSIAMLIALAVCLIPTTIGGLLSAIGIAGMDRVTQFNILAKSGRSVETCGDVNV LILDKTGTITYGNRMADAFIPVKSSSFERLVKAAYESSIADDTPEGRSIVKLAYKQHIDL PQEVGEYIPFTAETRMSGVKFTTREVYKGAPNSMVKRVKEAGGHIPVDLDALVKGVSKKG GTPLVVLEDNEILGVIYLKDVIKDGLVERFRELREMGIETVMCTGDNELTAATIAKEAGV DRFVAECKPEDKINVIREEQAKGHIVAMTGDGTNDAPALAEANVGLAMNSGTMSAKEAAN LIDLDSNPTKLMEVVLIGKQLLMTRGSLTTFSIANDIAKYFAILPAMFMAAMPAMNHLNI MHLHSPESAVLSALIFNALIIVLLIPIAMKGVKFKGASTQTILMKNMLVYGLGGMIVPFI GIKLIDLIIQLFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdpB1 |
Synonyms | kdpB1; SAV0073; Potassium-transporting ATPase ATP-binding subunit 1; ATP phosphohydrolase [potassium-transporting] B chain 1; Potassium-binding and translocating subunit B 1; Potassium-translocating ATPase B chain 1 |
UniProt ID | P0A007 |
◆ Recombinant Proteins | ||
PARP16-6505M | Recombinant Mouse PARP16 Protein, His (Fc)-Avi-tagged | +Inquiry |
ODF2-11073M | Recombinant Mouse ODF2 Protein | +Inquiry |
RFL30398ZF | Recombinant Full Length Zygosaccharomyces Rouxii Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged | +Inquiry |
AVEN-1249C | Recombinant Chicken AVEN | +Inquiry |
RFL11518AF | Recombinant Full Length Archaeoglobus Fulgidus Uncharacterized Protein Af_1562 (Af_1562) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A3-1771HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
JRK-2124HCL | Recombinant Human JRK cell lysate | +Inquiry |
POLK-3045HCL | Recombinant Human POLK 293 Cell Lysate | +Inquiry |
CREM-7283HCL | Recombinant Human CREM 293 Cell Lysate | +Inquiry |
SIGLEC5-1505HCL | Recombinant Human SIGLEC5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kdpB1 Products
Required fields are marked with *
My Review for All kdpB1 Products
Required fields are marked with *
0
Inquiry Basket