Recombinant Full Length Staphylococcus Aureus Poly-Beta-1,6-N-Acetyl-D-Glucosamine Synthase(Icaa) Protein, His-Tagged
Cat.No. : | RFL21405SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase(icaA) Protein (Q7A351) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | icaA |
Synonyms | icaA; SA2459; Poly-beta-1,6-N-acetyl-D-glucosamine synthase; PNAG synthase; Poly-beta-1,6-GlcNAc synthase; Biofilm polysaccharide intercellular adhesin synthesis protein IcaA; Biofilm PIA synthesis protein IcaA; Intercellular adhesion protein A; N-acetylg |
UniProt ID | Q7A351 |
◆ Native Proteins | ||
TTR-141S | Native Sheep prealbumin | +Inquiry |
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
FSH-1565S | Active Native Sheep Stimulating Hormone | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGP-4329HCL | Recombinant Human MGP 293 Cell Lysate | +Inquiry |
UHMK1-509HCL | Recombinant Human UHMK1 293 Cell Lysate | +Inquiry |
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
EPSTI1-6574HCL | Recombinant Human EPSTI1 293 Cell Lysate | +Inquiry |
HOXB1-810HCL | Recombinant Human HOXB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All icaA Products
Required fields are marked with *
My Review for All icaA Products
Required fields are marked with *
0
Inquiry Basket