Recombinant Full Length Staphylococcus Aureus Na(+)/H(+) Antiporter Subunit C1(Mnhc1) Protein, His-Tagged
Cat.No. : | RFL35114SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Na(+)/H(+) antiporter subunit C1(mnhC1) Protein (Q6GAX6) (1-113aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-113) |
Form : | Lyophilized powder |
AA Sequence : | MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhC1 |
Synonyms | mnhC1; SAS0820; Na(+/H(+ antiporter subunit C1; Mnh complex subunit C1 |
UniProt ID | Q6GAX6 |
◆ Recombinant Proteins | ||
CRYM-2144HF | Recombinant Full Length Human CRYM Protein, GST-tagged | +Inquiry |
IL23A&IL12B-1234H | Acitve Recombinant Human IL23A&IL12B protein(Met1-Ser328 & Arg20-Pro189), His-tagged | +Inquiry |
EGF-09H | Active Recombinant Human EGF Protein | +Inquiry |
TRIM71-5942R | Recombinant Rat TRIM71 Protein, His (Fc)-Avi-tagged | +Inquiry |
VEGFA-210HAF555 | Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Native Proteins | ||
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL8B-8704HCL | Recombinant Human ARL8B 293 Cell Lysate | +Inquiry |
TEX9-1138HCL | Recombinant Human TEX9 293 Cell Lysate | +Inquiry |
KLK12-4903HCL | Recombinant Human KLK12 293 Cell Lysate | +Inquiry |
MPST-4223HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
TCEB2-1188HCL | Recombinant Human TCEB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mnhC1 Products
Required fields are marked with *
My Review for All mnhC1 Products
Required fields are marked with *
0
Inquiry Basket