Recombinant Full Length Staphylococcus Aureus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL10308SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Lipoteichoic acid synthase(ltaS) Protein (Q6GIS3) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SAR0772; Lipoteichoic acid synthase |
UniProt ID | Q6GIS3 |
◆ Recombinant Proteins | ||
HPF1-2397H | Recombinant Human HPF1 Protein (1-346 aa), His-SUMO-Myc-tagged | +Inquiry |
SENP7-405H | Recombinant Human SENP7 Protein, His-tagged | +Inquiry |
BAG2-334R | Recombinant Rhesus Macaque BAG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERTM1-1323H | Recombinant Human SERTM1 | +Inquiry |
CA9-890H | Active Recombinant Human CA9 protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
LTF-312H | Native Human LTF protein | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPD2-1614HCL | Recombinant Human SNRPD2 293 Cell Lysate | +Inquiry |
KCNIP4-5051HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
DTNBP1-6796HCL | Recombinant Human DTNBP1 293 Cell Lysate | +Inquiry |
SDC2-1575HCL | Recombinant Human SDC2 cell lysate | +Inquiry |
HMGA2-5478HCL | Recombinant Human HMGA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket