Recombinant Full Length Staphylococcus Aureus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL26063SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Lipoteichoic acid synthase(ltaS) Protein (Q7A1I3) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; MW0681; Lipoteichoic acid synthase |
UniProt ID | Q7A1I3 |
◆ Recombinant Proteins | ||
Nucb2-4528M | Recombinant Mouse Nucb2 Protein, Myc/DDK-tagged | +Inquiry |
GRAMD2-7239M | Recombinant Mouse GRAMD2 Protein | +Inquiry |
AL529-RS08395-1284S | Recombinant Staphylococcus capitis (strain: FDAARGOS_173, nat-host: Homo sapiens, culture-collection: FDA:FDAARGOS_173) AL529_RS08395 protein, His-tagged | +Inquiry |
VWF-6569H | Recombinant Human VWF Protein (Ala23-Lys219), N-His tagged | +Inquiry |
SLC22A4-3926C | Recombinant Chicken SLC22A4 | +Inquiry |
◆ Native Proteins | ||
ALB-115C | Native Chicken Serum Albumin | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPN1-7310HCL | Recombinant Human CPN1 293 Cell Lysate | +Inquiry |
MAFF-4560HCL | Recombinant Human MAFF 293 Cell Lysate | +Inquiry |
Cerebellum-68C | Cynomolgus monkey Cerebellum Lysate | +Inquiry |
LYSMD2-1043HCL | Recombinant Human LYSMD2 cell lysate | +Inquiry |
C11orf48-8350HCL | Recombinant Human C11orf48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket