Recombinant Full Length Staphylococcus Aureus Lipoteichoic Acid Synthase(Ltas) Protein, His-Tagged
Cat.No. : | RFL12781SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Lipoteichoic acid synthase(ltaS) Protein (Q2YSL2) (218-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (218-646) |
Form : | Lyophilized powder |
AA Sequence : | SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKQQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS |
Synonyms | ltaS; SAB0668; Lipoteichoic acid synthase |
UniProt ID | Q2YSL2 |
◆ Recombinant Proteins | ||
KCNJ3-51H | Recombinant Human KCNJ3 protein, His-tagged | +Inquiry |
MPI-3736R | Recombinant Rat MPI Protein | +Inquiry |
MACROH2A1-3755H | Recombinant Human MACROH2A1 Protein (Ile109-Leu369), N-GST tagged | +Inquiry |
HOXB6-2150HFL | Recombinant Full Length Human HOXB6 Protein, C-Flag-tagged | +Inquiry |
SH-RS11980-5740S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS11980 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Mannose Binding Lectin-044H | Native Human Mannose Binding Lectin Protein | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CA-2951HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
FBXW2-6285HCL | Recombinant Human FBXW2 293 Cell Lysate | +Inquiry |
RUFY4-1551HCL | Recombinant Human RUFY4 cell lysate | +Inquiry |
PPP1R21-4897HCL | Recombinant Human KLRAQ1 293 Cell Lysate | +Inquiry |
Rectum-416R | Rhesus monkey Rectum Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ltaS Products
Required fields are marked with *
My Review for All ltaS Products
Required fields are marked with *
0
Inquiry Basket